PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016486992.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 300aa    MW: 33944.3 Da    PI: 6.7365
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016486992.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-19134188256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk+q  +Lee F+++++++ ++++ LAk+lgL  rqV vWFqNrRa+ k
  XP_016486992.1 134 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTK 188
                     678899***********************************************98 PP

2HD-ZIP_I/II128.92e-41134223191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+k+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  XP_016486992.1 134 RKKLRLTKDQSAVLEESFKEHNTLNPKQKQALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 223
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046184.6E-301111IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.38E-18128191IPR009057Homeodomain-like
PROSITE profilePS5007117.378130190IPR001356Homeobox domain
SMARTSM003893.0E-17132194IPR001356Homeobox domain
CDDcd000862.59E-15134191No hitNo description
Gene3DG3DSA:1.10.10.601.9E-18134188IPR009057Homeodomain-like
PfamPF000465.2E-17134188IPR001356Homeobox domain
PRINTSPR000311.5E-5161170IPR000047Helix-turn-helix motif
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
PRINTSPR000311.5E-5170186IPR000047Helix-turn-helix motif
PfamPF021832.3E-11190224IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-27190233IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MLENQDLGLS LSLGFPENKT TNPLQLNLIS SLVSSTSPSP SPFNLFQKTS WIDSFPSSDR  60
NLETCRTFLK GIDVNRIPTI TDAEEEEEEA GVSSPNSTIS SLSGNKRSER EINCEEELDC  120
CRGISDEEDG ETCRKKLRLT KDQSAVLEES FKEHNTLNPK QKQALAKRLG LRPRQVEVWF  180
QNRRARTKLK QTEVDCEFLK RCCENLTEEN RRLQKEVQEL RALKLSPQFY MQMTPPTTLT  240
MCPSCERVAG PPTPSPSGPT NVDPRVHQMG LAQQQRSMPF NLWATSPVPH RPINALNPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182190RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016486992.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-107HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLM1AXL41e-150M1AXL4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000325461e-150(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-104homeobox protein 2